Correction: A caspase-activated DNase that degrades DNA during apoptosis, and its inhibitor ICAD

Masato Enari, Hideki Sakahira, Hideki Yokoyama, Katsuya Okawa, Akihiro Iwamatsu and Shigekazu Nagata

Nature, 1998, vol. 393, issue 6683, 396-396

Abstract: Nature 391, 43–50 (1998) We have noticed that the sequence of murine CAD (Fig. 5d) carries an error. The sequence of the amino acids from 47 to 76 should read SRLCLYEDGTEVTDDCFPGLPNDAELLLL, instead of FPAVPVRRWHGGDGRLLPGPFPTTLSSYCF as published. The open reading frame of the cDNA (pEF-mCAD) consistsof 344 amino acids instead of 345 amino acids, and the mature murine CAD is a protein of 342 amino acids with a calculated relative molecular mass of 39,214.18.

Date: 1998
References: Add references at CitEc
Citations:

Downloads: (external link)
https://www.nature.com/articles/30782 Abstract (text/html)
Access to the full text of the articles in this series is restricted.

Related works:
This item may be available elsewhere in EconPapers: Search for items with the same title.

Export reference: BibTeX RIS (EndNote, ProCite, RefMan) HTML/Text

Persistent link: https://EconPapers.repec.org/RePEc:nat:nature:v:393:y:1998:i:6683:d:10.1038_30782

Ordering information: This journal article can be ordered from
https://www.nature.com/

DOI: 10.1038/30782

Access Statistics for this article

Nature is currently edited by Magdalena Skipper

More articles in Nature from Nature
Bibliographic data for series maintained by Sonal Shukla () and Springer Nature Abstracting and Indexing ().